PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G012491.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family WRKY
Protein Properties Length: 239aa    MW: 27218.1 Da    PI: 8.5948
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G012491.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.91.8e-32159217159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK vk+++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  HL.SW.v1.0.G012491.1 159 LDDGYRWRKYGQKAVKNNRFPRSYYRCTHHGCNVKKQVQRLTKDEGVVVTTYEGMHTHP 217
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-33144217IPR003657WRKY domain
SuperFamilySSF1182902.35E-29151218IPR003657WRKY domain
PROSITE profilePS5081129.585154219IPR003657WRKY domain
SMARTSM007742.0E-38159218IPR003657WRKY domain
PfamPF031063.2E-26160217IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MENYQMLFPC SSSSMAVSGY PAHVVSSTME SSQNNESAFS TGTAMEGLGG RISHGFLGLG  60
TENQNQNQNQ NYQNHQHLHH RDDQTAKMMT MMMMNNNKGH HDHDDHGDDD DQEQMGKKSI  120
SSSSAGTTNN CNNNDKKKGV KKVKKPKYAF QTRSQVDILD DGYRWRKYGQ KAVKNNRFPR  180
SYYRCTHHGC NVKKQVQRLT KDEGVVVTTY EGMHTHPIEK HTDNFEHILN QMHIYTPF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-27149216774Probable WRKY transcription factor 4
2lex_A4e-27149216774Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869717.16e-77PREDICTED: probable WRKY transcription factor 75
RefseqXP_015871944.16e-77PREDICTED: probable WRKY transcription factor 75
TrEMBLV7CWD64e-72V7CWD6_PHAVU; Uncharacterized protein
STRINGGLYMA16G05880.14e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.18e-56WRKY DNA-binding protein 75